JAZF1_MOUSE Q80ZQ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZQ5
Recommended name：Juxtaposed with another zinc finger protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：231986
Gene names (primary )：Jazf1
Gene names (synonym )：
Gene names (ORF )：
Length：243
Mass：27098
Sequence：MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEMIRKMQQ
Tissue specificity：Expressed in range of tissues with highest expression levels in testis, liver, muscle and fat and lowest levels in kidney (PubMed:25614086). Detected in liver and white adipose tissue (at protein level) (PubMed:24380856). {ECO:0000269|PubMed:24380856, ECO:0000269|PubMed:25614086}.
Induction：
Developmental stage：Expression is gradually but significantly up-regulated during adipocyte differentiation. {ECO:0000269|PubMed:24930994}.
Protein families：