NOCT_MOUSE O35710
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35710
Recommended name：Nocturnin
EC number：EC 3.1.3.-
Alternative names：(Carbon catabolite repression 4-like protein)
Cleaved into：
GeneID：12457
Gene names (primary )：Noct
Gene names (synonym )：Ccr4 Ccrn4l Noc
Gene names (ORF )：
Length：429
Mass：48301
Sequence：MYQSPRRLCSALLLRDAPGLRRTLVPGPRRTLAPPVLGSRPKSPQLQAAAASGAARSRPRTVSSMGNGTSRLYSALAKTVNSSAAAQHPEYLVSTDPEHLEPIDPKELLEECRAVLHTRPPRYQRDFVDLRTDCSSSHSPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLISSTNIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSPDGQSEPPYTTWKIRTSGECRHTLDYIWYSRHALSVTSALDLLTEEQIGPNRLPSFHYPSDHLSLVCDFSFNEEPHELF
Tissue specificity：Highly expressed in the differentiated adipocyte (at protein level). Ubiquitous. {ECO:0000269|PubMed:10521507, ECO:0000269|PubMed:11394964, ECO:0000269|PubMed:20392228}.
Induction：Immediate early gene (IEG) showing acute responses to several stimuli including serum shock, phorbol ester, lipopolysaccharide (LPS) and rosiglitazone, a PPARG agonist. Exhibits a high amplitude circadian rhythm with maximal levels in early evening. In constant darkness or constant light, the amplitude of the rhythm decreases. Expression is regulated by both light and food-entrained cues and by the CLOCK-ARNTL/BMAL1 heterodimer and PPARG. Up-regulated in cells undergoing adipogenesis. {ECO:0000269|PubMed:17400819, ECO:0000269|PubMed:20392228, ECO:0000269|PubMed:20685873, ECO:0000269|PubMed:22073225}.
Developmental stage：Expression is highest in oocytes, begins to decrease after fertilization by the 4-cell stage and then slightly increases up to the blastocyst stage. {ECO:0000269|PubMed:23449310}.
Protein families：CCR4/nocturin family