ZFP54_MOUSE E9PW05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9PW05
Recommended name：Zinc finger protein 54
EC number：
Alternative names：(Krueppel-associated box protein 10) (KRAB10)
Cleaved into：
GeneID：22712
Gene names (primary )：Zfp54
Gene names (synonym )：
Gene names (ORF )：
Length：585
Mass：68369
Sequence：MADSSVNLSQGLLTFRDVTVDFSQEEWECLDSAQRALYIEVMLENYSNLVYVENYCICDTVCQHVKTEKESCNELGEMLHEPSNCALYNRSDTTEASNNYRCCKDQDASLDSSNPDRLKSTHTGKERCESKDCAKSSSLCSSIAQDQRTNSTNKEQRQEKYDDHFISTHSLMQQAIYIGENPHQCMKYGKCFSSASSLGVQQRTDTGNKPYKCNICDKSFTECSSLKEHRKTHQRLRAGTNPYKCNDCGKSFSYLSALQSHHKRHTGEKRYKCKECGKSYAYRTGLKRHQKIHTAEECYSCQYCGKVFHQLSHFKSHFTLHTGEKPYKCNECHRSFPHYVFFRRHKKNHSLQKSHKCKECGKSFFILSHLKTHYRIHTGEKPYKCTKCDKLFTQYSHLRRHQRIYTGKKLYRCEVCDKWFTLSSSLSRHQKIHTEAKTYKCKDCDIFFNHYSSLRRHQKVHTGERHYTCKQCGKSFTRGSTLRVHQRIHTGEKPYKCSECDKSFTQASQLRTHQRVHTGEKPYVCKECGKSLTTCAILRAHQKIHTGEKPYKCMECDRSYIQYSHLKRHQKVHTGEKHKIVNNVT
Tissue specificity：Expressed at high levels in testis, may also be expressed at low levels in heart, brain, and skeletal muscle. {ECO:0000269|PubMed:10384051}.
Induction：
Developmental stage：Expression is initially maternally contributed, with increased expression at the two-cell stage followed by significant decrease at the 4-cell stage, remaining consistently low through to the morula stage (PubMed:20624068). Elevated expression in early embryonic stage (7 days post coitum (dpc)) with decreased but consistent expression thereafter in whole embryos (PubMed:10384051). Increased expression at 20 dpc in testis, with lower but consistent expression thereafter (PubMed:10384051). {ECO:0000269|PubMed:10384051, ECO:0000269|PubMed:20624068}.
Protein families：Krueppel C2H2-type zinc-finger protein family