ESP1_MOUSE Q3LHH8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3LHH8
Recommended name：Exocrine gland-secreted peptide 1
EC number：
Alternative names：
Cleaved into：
GeneID：619517
Gene names (primary )：Esp1
Gene names (synonym )：Gm6084
Gene names (ORF )：
Length：102
Mass：11346
Sequence：MTSLPVLLFLIILLLPSMITEGRVLTQTGKEATIFADQKTNHEADLKNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGRIK
Tissue specificity：Expressed in the extraorbital lacrimal gland from where it is secreted into tears. {ECO:0000269|PubMed:16208374}.
Induction：
Developmental stage：Expression is observed after 4 weeks of age in males only. Not expressed in females or in males castrated at 3 weeks of age whereas expression is not down-regulated in castrated adult males. {ECO:0000269|PubMed:16208374, ECO:0000269|PubMed:17935991}.
Protein families：Exocrine gland-secreted peptide family