ZFP59_MOUSE P16373
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16373
Recommended name：Zinc finger protein 59
EC number：
Alternative names：(Zfp-59) (Zinc finger protein Mfg-2)
Cleaved into：
GeneID：
Gene names (primary )：Zfp59
Gene names (synonym )：Mfg2
Gene names (ORF )：
Length：634
Mass：72538
Sequence：MLETYSNLVAVVGSCISKPNLIVLLEQEKEPWMAVNEETGRPSPDLEADYDAENISPQNRIYNRKFSKQSIKQLSRTFDPKGSWFSNGPNYSTFHGLRDCQSDAGQQITNKEGVPPHTCQTLAHNTEKPYECKECGKCFGCRSTLTQHQSVHTGEKPYECKECGKAFRLPQQLTRHQKCHSGEKPFSHNEGRQAFQHPNLLKYPKAIHTGAKAFACRECGKSFNRVSSLVEHGLIHADVKPYECNECGKAFKRHRSFVRHQKIHSGERPFQCKDCGKGFIVLAHLTRHQSSHSEEKPFECEECGKKFRTARHLVKHQRIHSGEKPFECNVCGSAFRLQLYLSEHQKTHMEEKYLECNVCGKAFRLQDILSEHLKTHTEENPFKCKLCGSSFPHKYQLNKHLTVHTDGKPYQCKECGKCFRQRSKLTEHESIHTGKKPFQCEACGKSLANTLLIHHQKSHSGERPFECKECGKAFLLPSQLNSHKIVHTSKRPFECKVCGKSFKRESNLIQHGAVHAGVKSYECSECGKGFIDRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLIEHQSIHTGEKPFECELCGSAFRCRSQLNKHLRIHTVRNITTVKNVGRPLVEYETCFDILNIIVIRSLMM
Tissue specificity：Expressed predominantly in the testis.
Induction：
Developmental stage：Expression is positively regulated upon differentiation. Is specifically synthesized during postmeiotic phase of male germline differentiation.
Protein families：Krueppel C2H2-type zinc-finger protein family