DBIL5_MOUSE   O09035


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09035

Recommended name:Diazepam-binding inhibitor-like 5

EC number:

Alternative names:(Endozepine-like peptide) (ELP)

Cleaved into:

GeneID:13168

Gene names  (primary ):Dbil5

Gene names  (synonym ):

Gene names  (ORF ):

Length:87

Mass:9865

Sequence:MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC

Tissue specificity:Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.

Induction:

Developmental stage:Expression is seen first at day 45 of post-natal development (post-meiotic transcription).

Protein families:ACBP family


   💬 WhatsApp