PHF7_MOUSE   Q9DAG9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAG9

Recommended name:PHD finger protein 7

EC number:

Alternative names:(Testis development protein NYD-SP6)

Cleaved into:

GeneID:71838

Gene names  (primary ):Phf7

Gene names  (synonym ):

Gene names  (ORF ):

Length:307

Mass:35381

Sequence:MKTLKEKNKHPRLRKTIRTKKVTQRKLSSSPVCLLCLQEPGDPEKLGEFLQKDNLCVHYFCLILSSRLPQKGQPNRGLHGFMPEDIKREAVRASKKICFVCKKKGAAIRCQNDQCVQNFHLPCGQERGCLSQFFGEYKSYCRKHRPTQNIHQGSLGEESCVLCCENLSRTSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDRDAAWELEPGAFSELYQRYRHCDAPICLYEQGRDSFEDEGRWRLILCATCGSHGTHRDCSSLRPNSKKWECNECLPASTTS

Tissue specificity:Highly expressed in Sertoli cells in testis. {ECO:0000269|PubMed:11829468}.

Induction:

Developmental stage:Expression levels increase during the first 4 weeks after birth and remain constant during the following 3 weeks. {ECO:0000269|PubMed:11829468}.

Protein families:


   💬 WhatsApp