FOXA3_MOUSE   P35584


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35584

Recommended name:Hepatocyte nuclear factor 3-gamma

EC number:

Alternative names:(HNF-3-gamma) (HNF-3G) (Forkhead box protein A3)

Cleaved into:

GeneID:15377

Gene names  (primary ):Foxa3

Gene names  (synonym ):Hnf3g Tcf-3g Tcf3g

Gene names  (ORF ):

Length:353

Mass:37601

Sequence:MLGSVKMEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMTLNPLSSPYPPGGLQASPLPTGPLAPPAPTAPLGPTFPSLGTGGSTGGSASGYVAPGPGLVHGKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSASRNGTAGSATSATTTAATAVTSPAQPQPTPSEPEAQSGDDVGGLDCASPPSSTPYFSGLELPGELKLDAPYNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLLNAS

Tissue specificity:Restricted mainly to endoderm-derived tissues (lung, liver, stomach, and small intestine), also present additionally in ovary, testis, heart, and adipose tissue, but missing from lung. {ECO:0000269|PubMed:17488644}.

Induction:

Developmental stage:Expression peaks around day 15.5 of gestation. Expressed from day 6 to day 70 during postnatal testicular development. {ECO:0000269|PubMed:17488644}.

Protein families:


   💬 WhatsApp