TIPIN_MOUSE Q91WA1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WA1
Recommended name：TIMELESS-interacting protein
EC number：
Alternative names：
Cleaved into：
GeneID：66131
Gene names (primary )：Tipin
Gene names (synonym )：
Gene names (ORF )：
Length：278
Mass：31498
Sequence：MLEQEENGLFEIPDYEHVEDETFPPFPPPASPERDPADAEPEEGSGSGVPVPPKRTVKRNLPKLDATRLTSERGLPALRHVFDKTKFKGKGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFIDRVENLGNKKEVQTCLKRIRLDLPIVHEDFVNNNDEVGEANGPDVSATGFDPFLTSSSDSRKFASEPTRSLTEEQQQRIERNKQLALERRQAKLLSNSQSLENDVTVEENSTGEDQEESNGLNIDTADGPHDVPFASTHEEEQCKAEETQLDHTNLD
Tissue specificity：Expressed in brain. {ECO:0000269|PubMed:12875843}.
Induction：
Developmental stage：Expression peaks between 11 dpc and 15 dpc. At 7.5 dpc, expressed in germ cell layers. At 14.5 dpc, expressed at highest levels in thymus, liver, gastrointestinal tract, lung and the rapidly proliferating ventricular zone of the brain. {ECO:0000269|PubMed:12875843}.
Protein families：CSM3 family