ZFP57_MOUSE   Q8C6P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C6P8

Recommended name:Zinc finger protein 57

EC number:

Alternative names:(Zfp-57)

Cleaved into:

GeneID:22715

Gene names  (primary ):Zfp57

Gene names  (synonym ):

Gene names  (ORF ):

Length:421

Mass:47959

Sequence:MAARKQSSQPSRTPVSYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVGSKKKPQEPSSDLQDKNEEQEKSSSCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTNPQSRKGKGYKAQHRGERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKPAASNQAGNQASNQRLKSRVPPTTPRSQAPALKYVKVIQGPVARAKARNSGASTLNVRSNSITVVRSREKISCPYCHITFTMRTCLLTHLKIHFRRQPNQHFCCKESAHSSNTLRMQKIYTCPVCDSSFRGKESLLDHLCCQRPIRFSKCWEILGHLLGYLHEPVVLGNIFKVRDSSGKRMESRRRRRKRACTENPETEGLSGKGRVAPWEMEGATSPESPVTEEDSD

Tissue specificity:Expressed in oocytes and in a subset of adult tissues. Expressed at high levels in testis, and at low levels in cerebellum. Present in sciatic nerve and spinal cord (at protein level). {ECO:0000269|PubMed:15070898, ECO:0000269|PubMed:8120052}.

Induction:Up-regulated by LIF. Down-regulated during differentiation of embryonic stem cells, or during retinoic acid-induced differentiation of F9 cells (at protein level). Regulated by JMJD1A, which mediates histone H3K9Me2 demethylation at its promoter, thereby activating expression. {ECO:0000269|PubMed:14732407, ECO:0000269|PubMed:15070898, ECO:0000269|PubMed:15845352, ECO:0000269|PubMed:17938240, ECO:0000269|PubMed:8120052}.

Developmental stage:Expression peaks between 11 dpc and 17 dpc, and decreases from P0 to P28. Expressed in lung throughout embryonic development. At 12 dpc, expressed in spinal cord, dorsal root ganglia and sciatic nerve. At 15 dpc, highly expressed in all neural tissues. At P0, expressed in brain and spinal cord. Present in Schwann cells at 16 dpc and P0 (at protein level). Maternal product is present in preimplantation embryos. Expressed in pluripotent embryonic stem cells. Down-regulated when embryonic stem cells differentiate. {ECO:0000269|PubMed:15070898, ECO:0000269|PubMed:18622393, ECO:0000269|PubMed:18854139, ECO:0000269|PubMed:8120052}.

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp