TXTP_MOUSE   Q8JZU2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8JZU2

Recommended name:Tricarboxylate transport protein, mitochondrial

EC number:

Alternative names:(Citrate transport protein) (CTP) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein)

Cleaved into:

GeneID:13358

Gene names  (primary ):Slc25a1

Gene names  (synonym ):

Gene names  (ORF ):

Length:311

Mass:33931

Sequence:MAAPRGPRALSAAAPGSGKPKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERANPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSRRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSSNPKYRGFFHGVREIIREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNHNKPMNPLITGVFGATAGAASVFGNTPLDVIKTRMQGLEAHKYRNTLDCGLKILKNEGPKAFYKGTVPRLGRVCLDVAIVFIIYDEVVKLLNKVWKTD

Tissue specificity:Expressed minimally but ubiquitously throughout the adult brain. Detected at higher levels in the olfactory bulb, neocortex and cerebellum. Also expressed in a subset of large cells in the globus pallidus. {ECO:0000269|PubMed:18775783}.

Induction:

Developmental stage:Expression reaches a maximum between 16 dpc and P0 and then declines in adulthood. {ECO:0000269|PubMed:18775783}.

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp