T22D4_MOUSE Q9EQN3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQN3
Recommended name：TSC22 domain family protein 4
EC number：
Alternative names：(TSC22-related-inducible leucine zipper protein 2) (Thg-1pit)
Cleaved into：
GeneID：78829
Gene names (primary )：Tsc22d4
Gene names (synonym )：Thg1pit Tilz2
Gene names (ORF )：
Length：387
Mass：39979
Sequence：MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI
Tissue specificity：
Induction：Up-regulated by TGF-beta treatment. {ECO:0000269|PubMed:11707329}.
Developmental stage：Expression starts at 8.5 dpc and undergoes a second peak of activation at 12.5 dpc. At 12.5 dpc, expression encompasses the entire central nervous system, with highest levels in the dorsal root and trigeminal ganglia. {ECO:0000269|PubMed:11707329}.
Protein families：TSC-22/Dip/Bun family