KLF7_MOUSE   Q99JB0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99JB0

Recommended name:Krueppel-like factor 7

EC number:

Alternative names:

Cleaved into:

GeneID:93691

Gene names  (primary ):Klf7

Gene names  (synonym ):

Gene names  (ORF ):

Length:301

Mass:33337

Sequence:MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKLLSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGADTCPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI

Tissue specificity:Widely expressed (PubMed:11336497). Detected in the cornea epithelium (at protein level) (PubMed:28916725). {ECO:0000269|PubMed:11336497, ECO:0000269|PubMed:28916725}.

Induction:

Developmental stage:Expression starts at 8.5 dpc in the trigeminal ganglion, the VII-VIII neural crest complex, and the subventricular neuroepithelium of both forebrain and hindbrain regions. At 11.5 dpc, expression is detected in the neural crest-derived sensory nervous system and, at 15.5 dpc, in the brain, spinal cord, retinal neuroepithelium and the inferior XI/X complex (PubMed:11336497, PubMed:11245580). In postnatal and adult animals, expression is confined to the cerebellum and dorsal root ganglia (PubMed:11336497). Expressed in the cornea epithelium at both 18.5 dpc and early postnatal (P5) but not at P50, when the corneal epithelium is fully differentiated (PubMed:28916725). {ECO:0000269|PubMed:11245580, ECO:0000269|PubMed:11336497, ECO:0000269|PubMed:28916725}.

Protein families:Krueppel C2H2-type zinc-finger protein family


   💬 WhatsApp