HPLN2_MOUSE Q9ESM3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ESM3
Recommended name:Hyaluronan and proteoglycan link protein 2
EC number:
Alternative names:(Brain link protein 1)
Cleaved into:
GeneID:73940
Gene names (primary ):Hapln2
Gene names (synonym ):Bral1
Gene names (ORF ):
Length:341
Mass:37925
Sequence:MPSRIPLPAFCCFLLPWAFTSFHKALGNPAPHPGPHYLLPPIHEVIHSRRGATATLPCVLGTSPPSYKVRWSKVEPGELRETLILITNGLHARDYGLLGGRASLRRGHRLDASLIIKNVRLEDEGRYRCELINGIEDESVALTLRLEGVVFPYQPSRGRYQFNYFEAKRACEEQDGRLATYGQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGHGRPGIRSYGPRDRSRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQASYGTYCYAEK
Tissue specificity:Brain. Predominantly expressed by neurons. Colocalizes with versican V2 in developing and adult cerebellar white matter and at the nodes of Ranvier. {ECO:0000269|PubMed:11027579}.
Induction:
Developmental stage:Expression starts at postnatal day 20 and increases thereafter.
Protein families:HAPLN family