CXAR_MOUSE   P97792


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97792

Recommended name:Coxsackievirus and adenovirus receptor homolog

EC number:

Alternative names:(CAR) (mCAR)

Cleaved into:

GeneID:13052

Gene names  (primary ):Cxadr

Gene names  (synonym ):Car

Gene names  (ORF ):

Length:365

Mass:39948

Sequence:MARLLCFVLLCGIADFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAGTIAGAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSKDGSIV

Tissue specificity:Expressed in liver, kidney, heart, lung, and brain. In skeletal muscle is found at the neuromuscular junction. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. {ECO:0000269|PubMed:10814828, ECO:0000269|PubMed:12763576, ECO:0000269|PubMed:15533241, ECO:0000269|PubMed:9096397}.

Induction:

Developmental stage:Expression starts in the embryonic ectoderm in the uterus on 6.5 dpc. Then it is strongly expressed in the neuroepithelium of the neural tube, the developing brain and the spinal cord from 8.5 dpc to postnatal day 7 (P7), in the cranial motor nerves from 9.5 dpc to 11.5 dpc, and in the optic nerve from 13.5 dpc to P7. Expression increases until perinatal period and decreases postnatally. Expressed in the immature neuroepithelium including progenitor cells it still occurs in a few proliferating cells of the hippocampal dentate gyrus, the subventricular zone of the lateral ventricles, and the rostral migratory stream over P21. Also expressed in heart, kidney and liver of newborn mice. {ECO:0000269|PubMed:10814828, ECO:0000269|PubMed:12763576}.

Protein families:


   💬 WhatsApp