ST1B1_MOUSE   Q9QWG7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QWG7

Recommended name:Sulfotransferase family cytosolic 1B member 1

EC number:EC 2.8.2.-

Alternative names:(ST1B1) (Sulfotransferase 1B1) (DOPA/tyrosine sulfotransferase)

Cleaved into:

GeneID:56362

Gene names  (primary ):Sult1b1

Gene names  (synonym ):

Gene names  (ORF ):

Length:299

Mass:34901

Sequence:MSASEDVWRKDLKMIHGYPMIYAFALNWERIEEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLELSVPGIRISGVELLKKTPSPRIIKTHLPIDLLPKSFWENKCKMIYLARNGKDVAVSYYHFDLMNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIASFLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAVYKKKMSGTTLEFCTDIQSA

Tissue specificity:Liver specific. {ECO:0000269|PubMed:9644246}.

Induction:

Developmental stage:Expression was detected at very low level in liver from 1 day-old and then gradually increased to the maximum level at 4 weeks old. {ECO:0000269|PubMed:9644246}.

Protein families:Sulfotransferase 1 family


   💬 WhatsApp