POPD2_MOUSE   Q9ES82


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ES82

Recommended name:Popeye domain-containing protein 2

EC number:

Alternative names:(Popeye protein 2)

Cleaved into:

GeneID:64082

Gene names  (primary ):Popdc2

Gene names  (synonym ):Pop2

Gene names  (ORF ):

Length:367

Mass:41252

Sequence:MSANGSSVAQLLWQPPVCRSWKPDVEGAVYHLANCFLLMGFMAGSGVYGCFYLFGILGPGYLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFNLLYRTLCLPLQVPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLHPSEEGTFQVTLTAETECSYISWPRKNLYLLLNRERYISRLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLSPSASDGEPESEKDDEEALEAAVSPAQARPICIVPTPPCSAPPATTNFPVPLPRARMPRMPRPDSGNLASRRPLQNSSQVMSRSQAPLAPIHTPEL

Tissue specificity:Expressed in the developing and adult heart, with high expression levels in the sinus and atrioventricular nodes. Also expressed in the bladder and skeletal muscle. {ECO:0000269|PubMed:10882522, ECO:0000269|PubMed:22354168}.

Induction:

Developmental stage:Expression was first detected at 7.5 dpc in the cardiac crescent. Expression was observed in the myocardial layer but not in the endocardium. Expression was homogeneous in all heart segments with the exception of the outflow tract. Between 9.5 dpc and 10.5 dpc expression was also observed in the trabeculated areas. In more advanced stages of myocardial differentiation, expression in the ventricle was largely restricted to the compact layer. {ECO:0000269|PubMed:10882522}.

Protein families:Popeye family


   💬 WhatsApp