DYLT1_MOUSE P51807
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51807
Recommended name：Dynein light chain Tctex-type 1
EC number：
Alternative names：(Activator of G-protein signaling 2) (AGS2) (T-complex testis-specific protein 1) (TCTEX-1)
Cleaved into：
GeneID：100040531
Gene names (primary )：Dynlt1
Gene names (synonym )：Tctel1 Tctex-1 Tctex1
Gene names (ORF )：
Length：113
Mass：12483
Sequence：MEDFQASEETAFVVDEVSSIVKEAIESAIGGNAYQHSKVNQWTTNVLEQTLSQLTKLGRPFKYIVTCVIMQKNGAGLHSASSCFWDSSTDGSCTVRWENKTMYCIVSTFGLSI
Tissue specificity：High level in testis (germ cell-specific). Expressed in sperm (at protein level). 200-fold lower in liver, brain, heart, spleen, and kidney. Levels in thymus and two embryonal carcinoma cell lines were several-fold higher than this low constitutive level. {ECO:0000269|PubMed:9490726}.
Induction：
Developmental stage：First abundantly expressed at the pachytene stage of meiosis and persists throughout spermatogenesis.
Protein families：Dynein light chain Tctex-type family