SPIKL_MOUSE Q8CEK3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CEK3
Recommended name：Serine protease inhibitor kazal-like protein, minor form
EC number：
Alternative names：(SPINKL, minor form)
Cleaved into：Serine protease inhibitor kazal-like protein, major form (SPINKL, major form)
GeneID：77424
Gene names (primary )：Spinkl
Gene names (synonym )：
Gene names (ORF )：
Length：90
Mass：10542
Sequence：MSSTWIKFLFILTLVLLPYSVFSVNIFAGPENVIKEPNCTMYKSKSECSNIAENPVCADDRNTYYNECYFCIEKVVEKLKYRYHGICIYK
Tissue specificity：Luminal fluid and mucosal folds of the seminal vesicles (at protein level). Not detected in brain, heart, lung, liver, kidney, stomach, small intestine, muscle, skin, thymus, placenta or bladder. {ECO:0000269|PubMed:18715980}.
Induction：By testosterone. {ECO:0000269|PubMed:18715980}.
Developmental stage：First appears at low levels in 3 week old mice. Levels increase rapidly after 4 weeks, highest levels are reached in 8 week old mice. {ECO:0000269|PubMed:18715980}.
Protein families：