PEBP2_MOUSE   Q8VIN1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VIN1

Recommended name:Phosphatidylethanolamine-binding protein 2

EC number:

Alternative names:(PEBP-2)

Cleaved into:

GeneID:

Gene names  (primary ):Pbp2

Gene names  (synonym ):Pebp2

Gene names  (ORF ):

Length:187

Mass:21191

Sequence:MPTDMSMWTGPLSLHEVDEQPQHLLRVTYTEAEVEELGQVLTPTQVKHRPGSISWDGLDPGKLYTLILTDPDAPSRKKPVYREWHHFLVVNMKGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFKTAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLSGK

Tissue specificity:Testis specific. {ECO:0000269|PubMed:12193403}.

Induction:

Developmental stage:First detected 14 day old testes, with the first appearance of stage IX pachytene spermatocytes. Highly expressed in stage X and XI pachytene and diplotene spermatocytes from day 18 to 22.

Protein families:Phosphatidylethanolamine-binding protein family


   💬 WhatsApp