LCN9_MOUSE   Q9D267


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D267

Recommended name:Epididymal-specific lipocalin-9

EC number:

Alternative names:(MUP-like lipocalin)

Cleaved into:

GeneID:77704

Gene names  (primary ):Lcn9

Gene names  (synonym ):

Gene names  (ORF ):

Length:178

Mass:20503

Sequence:MVLLLVLGLVLSLATAQFNLHTAVRRDYNLARISGTWYLDSIASDNMTRIEENGDLRLFIRNIKLLNNGSLQFDFHFMLQGECVAVTMVCEKTKNNGEFSVAYEGKNKVLLLETDYSMYIIFYMQNIKNGTKTQVLALYGRSILLDKTHQREFENICNLYGLDSQNIIDMTKKDFCFL

Tissue specificity:Expressed in epididymis. Not detected in all other tissues tested. {ECO:0000269|PubMed:15363845}.

Induction:

Developmental stage:First detected after 3 weeks postnatal development. {ECO:0000269|PubMed:15363845}.

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp