LBX2_MOUSE Q9WUN8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUN8
Recommended name：Transcription factor LBX2
EC number：
Alternative names：(Ladybird homeobox 2) (Ladybird homeobox protein homolog 2)
Cleaved into：
GeneID：16815
Gene names (primary )：Lbx2
Gene names (synonym )：Lbx2h
Gene names (ORF )：
Length：195
Mass：20917
Sequence：MNSVHQRRTPFSIADILGPSMVPEAPSAPQLPEAGPDPASPLCALEELASKTFLGHSPRATPQPSEGRAAPEAPPGPGAGVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLCGLSPGVLCYPALPDSTSSPDPGPSGPDSEPNLSDEEIQVDD
Tissue specificity：Expressed in the developing urogenital system, eye and brain. {ECO:0000269|PubMed:10473138}.
Induction：By PAX3 which regulates its expression. {ECO:0000269|PubMed:17492753}.
Developmental stage：First detected at 10.5 dpc in the gonadal component of the urogenital ridge. Expression dramatically increases by 11.5 dpc in the urogenital ridges and in the cranial surface ectoderm. At this time, it is also expressed in the trigeminal ganglion and nodose ganglion. At later stages, it is expressed in the brain and organs derived from the urogenital ridge, including the gonadal tubercle, kidneys, and adrenal glands. From 14.5 dpc to birth, expression is evident in the developing retinal neuroepithelium and the vibrissa. {ECO:0000269|PubMed:10473138, ECO:0000269|PubMed:11386758}.
Protein families：