SVS3A_MOUSE F2Z472
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F2Z472
Recommended name：Seminal vesicle secretory protein 3A
EC number：
Alternative names：(Seminal vesicle secretory protein III) (SVS III)
Cleaved into：
GeneID：64335
Gene names (primary )：Svs3a
Gene names (synonym )：Svs3
Gene names (ORF )：
Length：265
Mass：29967
Sequence：MKSIFFSLSLLLLLEKKAAGIELYAGGTKGHFLVKTSPLMFIGKNQFLYGHKEEQEEAPEESIFVQTKHHEYGQDADADMGGALSSQELTSLKEDIVCEEEDELAQQKSQLPSQSQIKSQTQVKSYAAQLKSQPGQLKTIGQVKSQTMLKSHGAPLKSFKARLNLREDIPQQVKGRGYGLAEDLAQVRQQPAKVHRLKGKHRQSRKTAAFYPQFRRRSRPYPRYFVQFQEQLQGSVHHTKSFYPGPGMCYCPRGGVILYQDAFTD
Tissue specificity：Highly expressed in the seminal vesicle where it is detected in luminal epithelium of the mucosa folds, and also in luminal fluid (at protein level). Not detected in other tissues tested. {ECO:0000269|PubMed:11723121}.
Induction：Up-regulated in response to androgens. {ECO:0000269|PubMed:11723121}.
Developmental stage：First detected at 3 weeks of age. Expression increases through to 6 weeks of age and remains high thereafter. {ECO:0000269|PubMed:11723121}.
Protein families：