OCAD1_MOUSE Q9CRD0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CRD0
Recommended name:OCIA domain-containing protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:68095
Gene names (primary ):Ociad1
Gene names (synonym ):Asrij
Gene names (ORF ):
Length:247
Mass:27610
Sequence:MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSSPPGHYTQKPKFDSNVSGQSSFGTSPAADNIEKEALPRYEPIPFSASMNESTPTGITDHIAQGPEPNLEESPKRKGVTYEELRSKNRESYGVTLPHKTDPSVRPMQERVPKKEVKVNKYGDTWDE
Tissue specificity:Expressed at high levels in the brain and at lower levels in the heart, ovary, testis and kidney. Expression is strongest in embryonic stem cells and in the blood vessels. {ECO:0000269|PubMed:12889067}.
Induction:Expression is down-regulated as differentiation proceeds in stem cells. {ECO:0000269|PubMed:23972987}.
Developmental stage:First detected at 6.5 dpc in the primitive streak region of the epiblast and extraembryonic vasculature. Expression in the 8.5 dpc yolk sac is seen within blood islands and the capillary plexus. As embryogenesis proceeds, expression becomes prominent in the blood islands and the primitive blood vessels of the yolk sac. By 8-8.5 dpc, a more generalized expression pattern is seen in the neural folds and caudally in the presomitic mesoderm and primitive streak regions. A definite increase in vascular expression is seen in the embryo by 9.5 dpc. Tissue-specific expression is initially seen from early 9.5 dpc in the anterior-most regions of the head, mainly in the optic vesicle and branchial arches. At 11.5 dpc and 13.5 dpc, strong expression is seen in the embryonic stem cells of the blood vessels, especially in the capillaries of the brain and in the hyaline vasculature of the eye. Weak expression is also seen in the lingual vessels and in the neural crest-derived regions of the jaw. A rapid increase in expression in the trunk is seen between 9.5 dpc and 10.5 dpc and by 13.5 dpc, expression is more localized. Expression is not detected in the embryonic heart at early 9.5 dpc and from 11.5 dpc onward, increasing expression is seen in the atrium, ventricle, and outflow tracts of the heart. {ECO:0000269|PubMed:12889067}.
Protein families:OCIAD1 family