LBH_MOUSE   Q9CX60


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CX60

Recommended name:Protein LBH

EC number:

Alternative names:(Limb bud and heart-expressed protein)

Cleaved into:

GeneID:77889

Gene names  (primary ):Lbh

Gene names  (synonym ):

Gene names  (ORF ):

Length:105

Mass:12138

Sequence:MSVYFPIHCSDYLRSAEMTEVMMNAPSMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETTNEKKDQ

Tissue specificity:Expressed at highest levels in heart, and at lower levels in brain, spleen, lung, liver and kidney. {ECO:0000269|PubMed:11336496}.

Induction:

Developmental stage:First detected at 7.5 dpc in the mesendoderm that forms the anterior gut and the heart. At midgestation, expressed in the limb bud ectoderm and other specialized epithelia, as well as in the branchial arches and some neural crest derivatives. In the heart, expression initiates in the myocardial plate at the presomitic stage, with highest levels in the anterior myocardium. During heart chamber formation, expressed transiently in the right ventricle, atrioventricular canal and inflow tract. In the limb bud, expression is restricted to the ventral ectodermal compartment and the apical ectodermal ridge. {ECO:0000269|PubMed:11336496}.

Protein families:LBH family


   💬 WhatsApp