HOP_MOUSE Q8R1H0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1H0
Recommended name：Homeodomain-only protein
EC number：
Alternative names：(Homeobox-only protein) (Odd homeobox protein 1) (mOB1)
Cleaved into：
GeneID：74318
Gene names (primary )：Hopx
Gene names (synonym )：Hod Hop Ob1
Gene names (ORF )：
Length：73
Mass：8282
Sequence：MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD
Tissue specificity：Expressed in the embryonic and adult heart and in the adult brain, liver, lung, skeletal muscle, intestine and spleen. Throughout embryonic and postnatal development, it is expressed in the myocardium. {ECO:0000269|PubMed:12297045, ECO:0000269|PubMed:12297046, ECO:0000269|PubMed:14516659}.
Induction：By the transcription factor NKX2-5 that acts as a direct regulator. {ECO:0000269|PubMed:12297045}.
Developmental stage：First detected at 7.75 dpc in trophoblasts within extraembryonic membranes, in the lateral wings of the cardiac crescent and in the anterior head folds. At 8.0 dpc, it is expressed along the length of the linear heart tube and in the head folds. Expressed throughout the myocardium at 9.5 dpc and in the branchial arches. At 12.5 dpc, it is expressed in the heart and in the ventricular zone of the neural tube. At 13.5 dpc, it is weakly expressed in the intestinal epithelium. At 13.5 dpc and 15.5 dpc, it is also expressed in skeletal muscle, stratified epithelium (upper aerodigestive tract and skin), epithelium of developing airways, vibrissae, midbrain/hindbrain junction, meninges, mesenchymal cellular condensations that preceded cartilage formation and chondrocytes. {ECO:0000269|PubMed:12297045, ECO:0000269|PubMed:12297046, ECO:0000269|PubMed:14516659}.
Protein families：