HHIP_MOUSE Q7TN16
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TN16
Recommended name：Hedgehog-interacting protein
EC number：
Alternative names：(HHIP) (HIP)
Cleaved into：
GeneID：15245
Gene names (primary )：Hhip
Gene names (synonym )：Hip
Gene names (ORF )：
Length：700
Mass：78513
Sequence：MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRVMSQLELLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQSLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCFPDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSHRLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGASSSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRVTVQPAQPLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV
Tissue specificity：In the adult brain, high expression found in the ventral cochlear nucleus, medial habenula, indusium griseum and tenia tecta. Some expression also in the caudate putamen, the nucleus accumbens, the ventral pallidum and in the superficial layers of the superior colliculus. {ECO:0000269|PubMed:15019948}.
Induction：
Developmental stage：First detected at 8.75 dpc, in the ventral midline of the neural tube and in the ventral medial somites. At 10.5 dpc, expression in the notochord is maintained in the caudal region. Expression is lost in the floor plate, but is retained in the ventral half of the neural tube and in the sclerotome of the adjacent somites. In the midbrain, expression confined to two lateral stripes adjacent to the floor plate. Also expressed in the gut mesenchyme along the length of the gastro-intestinal tract and in the mesenchyme of the posterior half of the limb. Expressed in the underlying mesenchyme of the epithelium of a number of tissues including lung, gut and whisker. Also expressed in the perichondrium and in the androgen-producing interstitial somatic cells of the developing testis. {ECO:0000269|PubMed:10050855}.
Protein families：HHIP family