OSR2_MOUSE Q91ZD1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZD1
Recommended name:Protein odd-skipped-related 2
EC number:
Alternative names:
Cleaved into:
GeneID:107587
Gene names (primary ):Osr2
Gene names (synonym ):
Gene names (ORF ):
Length:312
Mass:35454
Sequence:MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPSVHEITRSTITEMAAAQGLVDARFPFPSLPFATHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQNF
Tissue specificity:
Induction:
Developmental stage:First detected at 9.25 dpc, specifically in the mesonephric vesicles. By 10.0 dpc expression is also observed in the rostro-lateral mandibular mesenchyme immediately adjacent to the maxillary processes. In the developing limb buds it is expressed in a unique mesenchymal domain and the onset of the expression follows a distinct dorsal to ventral developmental time sequence beginning in the forelimb and then in the hindlimb. It exhibits a dynamic expression pattern during craniofacial development, in the mandibular and maxillary processes as well as the developing palate. It is also expressed at sites of epithelial-mesenchymal interactions during tooth and kidney development. {ECO:0000269|PubMed:11520675}.
Protein families:Odd C2H2-type zinc-finger protein family