PC4L1_MOUSE   Q6W8Q3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6W8Q3

Recommended name:Purkinje cell protein 4-like protein 1

EC number:

Alternative names:(PCP4-like protein 1)

Cleaved into:

GeneID:66425

Gene names  (primary ):Pcp4l1

Gene names  (synonym ):

Gene names  (ORF ):

Length:68

Mass:7502

Sequence:MSELNTKTPPAANQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS

Tissue specificity:Expressed in laminar and nuclear structures of the CNS. {ECO:0000269|PubMed:15053978}.

Induction:

Developmental stage:First detected at 9.5 dpc in the neural tube. Expressed at early stages of development in the isthmus and in metencephalic and mesencephalic roof plates. At later stages of development, it is expressed in structures corresponding to circumventricular organs which in adult control the production of the cerebrospinal fluid. {ECO:0000269|PubMed:15053978}.

Protein families:PCP4 family


   💬 WhatsApp