TEX22_MOUSE Q9D9U4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D9U4
Recommended name：Testis-expressed protein 22
EC number：
Alternative names：(Testis-expressed protein of 22 kDa)
Cleaved into：
GeneID：75671
Gene names (primary )：Tex22
Gene names (synonym )：Tep22
Gene names (ORF )：
Length：189
Mass：21502
Sequence：MDSRQQRPQRKTLQWQLAQEQRQQSPPQGLAVASSQPDTKSKPQDDLQTQDWVCEPQELRRPGSRWNISIDERRRLALQRMQERTDTARAPSGDPLGLHPEGQQTETSPSTQSVPTPPLQACETMADPLQDIAHVLAELMSEGVERDVLISQPLRSTENSNAFQDFLAQDAPLWKDENFEAQTSRWPHS
Tissue specificity：Mainly expressed in spermatocytes and spermatids in testis. {ECO:0000269|PubMed:12359214}.
Induction：
Developmental stage：First detected in 18-day-old mice (at protein level). {ECO:0000269|PubMed:12359214}.
Protein families：