SPR1A_MOUSE Q62266
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62266
Recommended name：Cornifin-A
EC number：
Alternative names：(Small proline-rich protein 1A) (SPR1 A) (SPR1A)
Cleaved into：
GeneID：20753
Gene names (primary )：Sprr1a
Gene names (synonym )：
Gene names (ORF )：
Length：144
Mass：15765
Sequence：MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK
Tissue specificity：Expressed in fetal periderm, hair follicles and in the thickened epidermis of the lip and footpad. Also present in the epithelia of various tissues such as the penis, vagina, forestomach, tongue and esophagus. {ECO:0000269|PubMed:8601731}.
Induction：
Developmental stage：First detected in fetal skin around day 16 and expression continues throughout newborn and adult stages. {ECO:0000269|PubMed:8601731}.
Protein families：Cornifin (SPRR) family