DRC9_MOUSE Q80W32
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80W32
Recommended name：Dynein regulatory complex protein 9
EC number：
Alternative names：(IQ domain-containing protein G)
Cleaved into：
GeneID：69707
Gene names (primary )：Iqcg
Gene names (synonym )：Drc9
Gene names (ORF )：
Length：419
Mass：49168
Sequence：MDEEEVEVVESPSEVLQPEVTVVVTGEPPEAAEEDLDYEEEEETSPEVIETLSLLDVLRVSAVMEDVIDQLSILGYIIPVQYERRQSLTQKASHEGASMITTTPKKSTSLLTKEKSMMAENKQRGQDFTFKKPTKQTMMTLETLKKIQNDRQYFSDVIANAMMEMQDSGSFTSLLKALGKERDSKMNFHDVITREEKGRKQIKTLQKQLLDVKRERQMQVQNGNEYIAHLRDQLQEMKAKTNLENLYMKRNAELQISQTQKKCNRAEELLLEEIEKLRMKTEEENRVHTEIEMFLKKQQQKLEEKLEFWMEKFDKDTEAKQNELNALKAAKASDLVHLQDLAKMIREYEQVIIEDRIEKEKTRKKLEQDDLELRSIVKLQAWWRGSVVRKEIGNFKMPKKDKDDSKDSKGKEKEKRRKK
Tissue specificity：Detected in testis (PubMed:24362311, PubMed:24849454). Also detected in oviduct (at protein level) (PubMed:24849454). Detected in testis (PubMed:24362311, PubMed:24849454). Also detected in oviduct and trachea (PubMed:24849454). {ECO:0000269|PubMed:24362311, ECO:0000269|PubMed:24849454}.
Induction：
Developmental stage：First detected in testis 17 days after birth when pachytene spermatocytes are seen in testes. Expression remains high during the first three weeks after birth and in adults (at protein level). {ECO:0000269|PubMed:24362311}.
Protein families：DRC9 family