ATOH1_MOUSE   P48985


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48985

Recommended name:Protein atonal homolog 1

EC number:

Alternative names:(Helix-loop-helix protein mATH-1) (mATH1)

Cleaved into:

GeneID:11921

Gene names  (primary ):Atoh1

Gene names  (synonym ):Ath1

Gene names  (ORF ):

Length:351

Mass:37854

Sequence:MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS

Tissue specificity:Developing nervous system, and in adult epithelial cells of the gastrointestinal tract.

Induction:

Developmental stage:First detected in the cranial ganglions and the dorsal part of the central nervous system on 9.5 dpc. From 10.5 dpc onward, prominent expression of MATH-1 continues in the dorsal part of the central nervous system but becomes restricted to the external granular layer of the cerebellum by 18 dpc and is undetectable in the adult nervous system.

Protein families:


   💬 WhatsApp