RU1C_MOUSE Q62241
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62241
Recommended name:U1 small nuclear ribonucleoprotein C
EC number:
Alternative names:(U1 snRNP C) (U1-C) (U1C)
Cleaved into:
GeneID:20630
Gene names (primary ):Snrpc
Gene names (synonym ):Snrp1c
Gene names (ORF ):
Length:159
Mass:17364
Sequence:MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPAPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Tissue specificity:Widely expressed. In the testis, expressed in somatic and germinal testicular cells but not in elongated spermatids.
Induction:
Developmental stage:First detected in the testis 18 days after birth. Levels increase successively between days 21-28. On day 42, levels decrease.
Protein families:U1 small nuclear ribonucleoprotein C family