ISK2_MOUSE Q8BMY7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BMY7
Recommended name:Serine protease inhibitor Kazal-type 2
EC number:
Alternative names:
Cleaved into:
GeneID:69982
Gene names (primary ):Spink2
Gene names (synonym ):
Gene names (ORF ):
Length:86
Mass:9722
Sequence:MLRLVLLLLVTDFAASHETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Tissue specificity:Expressed in sperm (at protein level). Expressed in testis but not in ovary, brain, heart, kidney or lung. Within testis, expressed in epididymis and germ cells. {ECO:0000269|PubMed:21705336, ECO:0000269|Ref.4}.
Induction:
Developmental stage:First expressed at 16 days postpartum (dpp). Level increases until 20 dpp and is maintained into adulthood (at protein level). {ECO:0000269|PubMed:21705336}.
Protein families: