GDAP1_MOUSE O88741
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88741
Recommended name：Ganglioside-induced differentiation-associated protein 1
EC number：
Alternative names：(GDAP1)
Cleaved into：
GeneID：14545
Gene names (primary )：Gdap1
Gene names (synonym )：
Gene names (ORF )：
Length：358
Mass：41311
Sequence：MARRQDEARAGVPLRVEGPPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGSTLVVGLLVGMGYFAFMLFRRRLGSMILALRPRPNYF
Tissue specificity：Expressed in brain, spinal cord, muscles and intestinal villi. In the central nervous system expressed most prominently in the cortex, cerebellum, thalamus, olfactory bulb, and spinal cord. Expressed also in sciatic nerves and in dorsal root ganglia. {ECO:0000269|PubMed:16172208}.
Induction：Increased expression during neural differentiation. {ECO:0000269|PubMed:10217254}.
Developmental stage：First expressed at embryonic stage 13 dpc. Levels then increase gradually to reach maximum levels at adulthood.
Protein families：GST superfamily