PIRT_MOUSE Q8BFY0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BFY0
Recommended name：Phosphoinositide-interacting protein
EC number：
Alternative names：
Cleaved into：
GeneID：193003
Gene names (primary )：Pirt
Gene names (synonym )：
Gene names (ORF )：
Length：135
Mass：15264
Sequence：MEVLPKALEVDERSPESKDLLPSQTASSLCISSRSESVWTTTPKSNWEIYHKPIIIMSVGAAILLFGVAITCVAYILEEKHKVVQVLRMIGPAFLSLGLMMLVCGLVWVPIIKKKQKQRQKSNFFQSLKFFLLNR
Tissue specificity：Strongly expressed in most dorsal root ganglia (DRG) and trigeminal neurons. Expressed by most peptidergic (CGRP+) and non-peptidergic (IB4+) DRG neurons. Weakly expressed in other parts of the peripheral nervous system (PNS) including sympathetic and enteric neurons. Not expressed in the spinal cord. {ECO:0000269|PubMed:18455988}.
Induction：
Developmental stage：First expressed in DRG neurons around embryonic day 11.5, and expression is maintained throughout adulthood. {ECO:0000269|PubMed:18455988}.
Protein families：