DAZP1_MOUSE Q9JII5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JII5
Recommended name：DAZ-associated protein 1
EC number：
Alternative names：(Deleted in azoospermia-associated protein 1)
Cleaved into：
GeneID：70248
Gene names (primary )：Dazap1
Gene names (synonym )：
Gene names (ORF )：
Length：406
Mass：43214
Sequence：MNSAGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKNQAPGQPGASQWGSRVAPSAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Tissue specificity：Mainly expressed in testis. Expressed at much lower level in liver, heart and brain. Also expressed in ovary. Expressed throughout testes development, in both the prenatal and postnatal periods. {ECO:0000269|PubMed:11604102}.
Induction：
Developmental stage：First expressed in midpachytene spermatocytes in stage VII tubules.
Protein families：