CD048_MOUSE Q3UR78
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UR78
Recommended name：Neuropeptide-like protein C4orf48 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：381633
Gene names (primary )：Gm1673
Gene names (synonym )：
Gene names (ORF )：
Length：90
Mass：9806
Sequence：MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR
Tissue specificity：Specifically expressed during neocortex and cerebellum development. {ECO:0000269|PubMed:21287218}.
Induction：
Developmental stage：First expressed in the cerebral cortex after the preplate stage (>E12). At embryonic stage 15.5 dpc and up to 17.5 dpc, it is expressed in cortical plate and in the marginal zone, whereas in adult brain, it is present in all cortical and subcortical regions of the brain. In the developing cerebellum, expressed in the intermediate zone at stage 17.5 dpc, in the molecular layer in newborn, and in the granular as well as molecular layer in adult. In the adult brain, expression in interneurons is also observed. {ECO:0000269|PubMed:21287218}.
Protein families：