TDGF1_MOUSE P51865
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51865
Recommended name：Teratocarcinoma-derived growth factor
EC number：
Alternative names：(Cripto growth factor) (Epidermal growth factor-like Cripto protein)
Cleaved into：
GeneID：
Gene names (primary )：Tdgf1
Gene names (synonym )：Cripto
Gene names (ORF )：
Length：171
Mass：18754
Sequence：MGYFSSSVVLLVAISSAFEFGPVAGRDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASRTPCQTPSVTTTFMLAGACLFLDMKV
Tissue specificity：Expressed at low level in specific organs of the adult animal such as spleen, heart, lung and brain. During gastrulation, expressed in the forming mesoderm. In later stages of the developing heart, expression is restricted to the truncus arteriosus.
Induction：
Developmental stage：First expressed prior to the onset of gastrulation (early streak stage), then continues throughout embryonic development.
Protein families：EGF-CFC (Cripto-1/FRL1/Cryptic) family