TRIM9_MOUSE Q8C7M3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C7M3
Recommended name：E3 ubiquitin-protein ligase TRIM9
EC number：EC 2.3.2.27
Alternative names：(RING-type E3 ubiquitin transferase TRIM9) (Tripartite motif-containing protein 9)
Cleaved into：
GeneID：94090
Gene names (primary )：Trim9
Gene names (synonym )：Kiaa0282
Gene names (ORF )：
Length：817
Mass：90870
Sequence：MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEAAGAHETKPMKDTDSEEQTLPFPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDFRSSPHQLSLHSSLQSLNAPGCNFETQSASYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGLFFPAVSLNRNVQVSLWAPGLRACSGCYFKVCPGAVKSPQAPAP
Tissue specificity：Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex. {ECO:0000269|PubMed:11960705, ECO:0000269|PubMed:20085810}.
Induction：
Developmental stage：First seen at 9.5 dpc. From 9.5 dpc to 11.5 dpc, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at 13.5 dpc and 15.5 dpc when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord. {ECO:0000269|PubMed:11960705}.
Protein families：TRIM/RBCC family