ERR2_MOUSE Q61539
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61539
Recommended name：Steroid hormone receptor ERR2
EC number：
Alternative names：(Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)
Cleaved into：
GeneID：26380
Gene names (primary )：Esrrb
Gene names (synonym )：Err-2 Err2 Nr3b2
Gene names (ORF )：
Length：433
Mass：48328
Sequence：MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Tissue specificity：Highly expressed in undifferentiated ESCs (PubMed:23508100). Expressed in immature horizontal cells and in rod photoreceptors at intermediate and late stages of differentiation (PubMed:20534447). Expressed in endolymph-producing epithelial cells (PubMed:17765677). {ECO:0000269|PubMed:17765677, ECO:0000269|PubMed:20534447, ECO:0000269|PubMed:23508100}.
Induction：Induced by NANOG (PubMed:23040477). Induced by GSK3 inhibition through inhibition of TCF3 repression. Repressed by TCF3 (PubMed:23040478). Reduced upon differentiation induced by LIF depletion (PubMed:23508100). {ECO:0000269|PubMed:23040477, ECO:0000269|PubMed:23040478, ECO:0000269|PubMed:23508100}.
Developmental stage：Found in the extra-embryonic ectoderm at 5.5 dpc, 6 dpc and 6.5 dpc. At 7.5 dpc, is exclusively detected in chorion, and at 8.5 dpc is present only at its free margin. Expression is not detected in the ectoplacental cone at any stage of development, nor is placental expression detected after 8.5 dpc. {ECO:0000269|PubMed:9285590}.
Protein families：Nuclear hormone receptor family, NR3 subfamily