NANO3_MOUSE P60324
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60324
Recommended name：Nanos homolog 3
EC number：
Alternative names：(NOS-3)
Cleaved into：
GeneID：244551
Gene names (primary )：Nanos3
Gene names (synonym )：Nos3
Gene names (ORF )：
Length：178
Mass：19241
Sequence：MGTFNLWTDYLGLARLVGALHKEEELDVRLDPKPEPKPSSESQQASKESSAAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSVYCYTTRNSAGKKLTRPDKAKTQDAGHRLGGEAAAGVYAGSKSGRKPPGPSPSACCPSTTA
Tissue specificity：Expressed in undifferentiated spermatogonial cells. {ECO:0000269|PubMed:12947200, ECO:0000269|PubMed:18089289, ECO:0000269|PubMed:19861488}.
Induction：
Developmental stage：Found in the male and female gonads of early embryo and, after birth, it is found only in the testis. Expressed in primordial germ cells (PGCs) until 14.5 dpc in male gonad and until 13.5 dpc in female gonad; after this age its expression disappears and then it is found after birth only in male germ cells. {ECO:0000269|PubMed:12947200, ECO:0000269|PubMed:17138666, ECO:0000269|PubMed:18089289, ECO:0000269|PubMed:19861488}.
Protein families：Nanos family