VWC2L_MOUSE Q505H4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q505H4
Recommended name：von Willebrand factor C domain-containing protein 2-like
EC number：
Alternative names：(Brorin-like)
Cleaved into：
GeneID：320460
Gene names (primary )：Vwc2l
Gene names (synonym )：
Gene names (ORF )：
Length：222
Mass：24528
Sequence：MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPIYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDDCNICHCHNGDWWKPAQCSKRECQGKQTV
Tissue specificity：Predominantly expressed in the brain (at protein level). Also detected in bones, including femur and calvaria, heart, lung and kidney. Isoform 5 is predominant in lung and heart, compared to isoforms 1 and 3. Isoform 4 is expressed in femur and calvaria at higher levels than isoforms 1 and 5. Isoforms 1 and 4 are expressed at higher levels than isoform 5 in kidney and brain. {ECO:0000269|PubMed:19852960, ECO:0000269|PubMed:22209847, ECO:0000269|PubMed:22632720}.
Induction：
Developmental stage：From 12.5 dpc to 18.5 dpc, expressed in the developing neural tissues, including several discrete regions in the forebrain, midbrain and hindbrain, as well as in the spinal cord. May be up-regulated in the course of preosteblast differentiation and matrix mineralization. {ECO:0000269|PubMed:19852960, ECO:0000269|PubMed:22209847}.
Protein families：