NTAL_MOUSE Q9JHL0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHL0
Recommended name：Linker for activation of T-cells family member 2
EC number：
Alternative names：(Linker for activation of B-cells) (Membrane-associated adapter molecule) (Non-T-cell activation linker) (Williams-Beuren syndrome chromosomal region 15 protein homolog)
Cleaved into：
GeneID：56743
Gene names (primary )：Lat2
Gene names (synonym )：Lab Ntal Wbscr15 Wbscr5
Gene names (ORF )：
Length：203
Mass：22876
Sequence：MSAELELLWPVSGLLLLLLGATAWLCVHCSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQMDTAPNKSFERKNKMLFSHLEGPESPRYQNFYKGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPSTPESGVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDVAAAENI
Tissue specificity：Strongly expressed in testis. Expressed in heart, spleen and lung. Present in B-cells and mast cells (at protein level). {ECO:0000269|PubMed:11124535, ECO:0000269|PubMed:15477350, ECO:0000269|PubMed:15539154}.
Induction：
Developmental stage：Hardly expressed in pro-B and pre-B cells. Moderately expressed in immature B-cells, mature B-cells and plasma cells. Highly expressed in transitional B-cells. {ECO:0000269|PubMed:15899851}.
Protein families：