GSC2_MOUSE P56916
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56916
Recommended name：Homeobox protein goosecoid-2
EC number：
Alternative names：(GSC-2) (Homeobox protein goosecoid-like) (GSC-L)
Cleaved into：
GeneID：195333
Gene names (primary )：Gsc2
Gene names (synonym )：Gscl
Gene names (ORF )：
Length：198
Mass：21765
Sequence：MATAGSAASRRDPGRPCPFSIEHILSSLPERRPATRPPQPVGGRNPAELDEPEAPVPAAPCACCCCCNPRAATRGTPETAGLRLAWPLRLAPATPSPLTAPRAGSPALTGTSGPGPQRRTRRHRTIFSEEQLQALEALFVQNQYPDVGTRERLAVRIRLREERVEVWFKNRRAKWRHQKRASSSRLLPGTKKTPKESC
Tissue specificity：Expressed in adult testis. {ECO:0000269|PubMed:9441739}.
Induction：
Developmental stage：Has a biphasic expression. Present in embryos in 8.5-10.5 dpc, reduced levels in 11.5 dpc and 13.5 dpc and absent in 15.5 dpc. Found in some adult tissues.
Protein families：Paired homeobox family, Bicoid subfamily