MBNL3_MOUSE Q8R003
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R003
Recommended name：Muscleblind-like protein 3
EC number：
Alternative names：(Cys3His CCG1-required protein) (Muscleblind-like X-linked protein) (Protein MCHCR)
Cleaved into：
GeneID：171170
Gene names (primary )：Mbnl3
Gene names (synonym )：Chcr Mbxl
Gene names (ORF )：
Length：342
Mass：37570
Sequence：MTPVNVALIRDTKWLTLEVCREFQRGTCSRADAECRFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKSQLEVNGRNNLIQQKTAAAMFAQHMQLMLQNAQMSSLASFPMNPSLAANPAMAFNPYMTHPGMGLVPAELLPNGPVLISGNPPLALPGVPGPKPIRTDRLEVCREFQRGNCTRGESECRYAHPTDVSMIEVTDNSVTICMDYIKGRCSREKCKYFHPPPHLQAKLRAAHHQMNHSAANAMALPHGALQLIPKRSALDKANGATPVFNPSVFHCQQALANMQIPQQAFIPTVPMMHGATPSTVSTATPPASNVPYVPTTTGNQLKY
Tissue specificity：
Induction：
Developmental stage：High expression in proliferating myoblasts is strongly reduced in differentiated muscle cells.
Protein families：Muscleblind family