PLAG1_MOUSE Q9QYE0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYE0
Recommended name：Zinc finger protein PLAG1
EC number：
Alternative names：(Pleiomorphic adenoma gene 1 protein)
Cleaved into：
GeneID：56711
Gene names (primary )：Plag1
Gene names (synonym )：
Gene names (ORF )：
Length：499
Mass：55579
Sequence：MATVIPGDLSEVRDTQKAPSGKRKRGESKPRKNFPCQLCDKAFNSVEKLKVHSFSHTGERPYKCTHQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQNFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCERRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDAVHPSHHLAFKCPFSSTSYAISIPEKEQPLKGEIESYLMELQGGAPSSSQDSPASSSKLGLEPQSGSPDDGAGDLSLSKSSISISDPLSTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPTQTQDLQDPANTVGLSSLHSLSAAFTSSLSSSTTLPRFHQAFQ
Tissue specificity：Expressed in heart, spleen, lung, kidney, brain, testis and epididymis but not in salivary glands. {ECO:0000269|PubMed:16193498}.
Induction：
Developmental stage：High fetal expression with a strong decline after birth. Expressed at 9.5 dpc and 10.5 dpc in nervous system with highest level in telencephalon, diencephalon, and midbrain, as well as regionalized expression in the neural tube, which is characteristic of genes involved in the specification of neuronal fates. {ECO:0000269|PubMed:15606491, ECO:0000269|PubMed:16193498}.
Protein families：Krueppel C2H2-type zinc-finger protein family