S35C2_MOUSE Q8VCX2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VCX2
Recommended name：Solute carrier family 35 member C2
EC number：
Alternative names：(Ovarian cancer-overexpressed gene 1 protein)
Cleaved into：
GeneID：228875
Gene names (primary )：Slc35c2
Gene names (synonym )：Ovcov1
Gene names (ORF )：
Length：364
Mass：40302
Sequence：MGRWALDVAFVWKAALTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHKARVVLSWTDYLRRVAPTALATALDVGLSNWSFLYITVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQILLQKADLGLQNPIDTMFHLQPLMFLGLFPLFAIFEGLHLSTSEKIFRFQDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKPLKSLGSSADLELLLRSSQQEEEDGEEEYFVTQGQQ
Tissue specificity：
Induction：
Developmental stage：Higher expression at embryo stage 7.5 dpc than 11-17 dpc. {ECO:0000269|PubMed:12461647}.
Protein families：TPT transporter family, SLC35C subfamily