PR7A1_MOUSE O54830
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54830
Recommended name：Prolactin-7A1
EC number：
Alternative names：(Placental prolactin-like protein E) (PLP-E) (PRL-like protein E) (Placental prolactin-like protein G) (PLP-G) (PRL-like protein G)
Cleaved into：
GeneID：19113
Gene names (primary )：Prl7a1
Gene names (synonym )：Prlpe Prlpg
Gene names (ORF )：
Length：266
Mass：29828
Sequence：MPLSFTQPCSSGALLLLVVSNLLLWENVACLPLSSNDTDDDPLSIKGLLDHAMILSKNITDLNMELRRIFTISEMSAKLIDKFLSSSSSSDSYDQFMLEFLGQQELLTKNLTYCHKYSIKVPEDIEEAQNVISLEDFPILILSRMQAWNETLKNRINLSEGTPGIDDDILPIYKNIETKIAELLEDSKSILSQAYGATENVADYTLWSGLEDLQSSDEETRFLALCKLSYCLHVDIHTANFYLQFLRCVALVNSDSCLSSKTGNDS
Tissue specificity：Expressed specifically in the placenta. Detected only in the trophoblast giant cells.
Induction：
Developmental stage：Highest expression at mid-pregnancy.
Protein families：Somatotropin/prolactin family